PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011094236.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family TALE
Protein Properties Length: 710aa    MW: 76705.4 Da    PI: 7.8678
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011094236.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox283.7e-094044411954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  XP_011094236.1 404 FEHflHPYPKDSDKLMLAKQTGLTRSQVSNWFINARVR 441
                     554459******************************88 PP

2BELL109.71.7e-35268339172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     erqe+q+kkakL+++l+eV++rY+qy++q+q+vis    +ag+gsak Yt+lAl++iS++FrcLkdai +qi
  XP_011094236.1 268 ERQEIQMKKAKLVNMLDEVEQRYRQYHHQMQIVISWTSSAAGIGSAKTYTALALQTISKQFRCLKDAILGQI 339
                     79********************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.2E-62193337IPR006563POX domain
PfamPF075261.6E-47198335IPR006563POX domain
PROSITE profilePS5007112.147382445IPR001356Homeobox domain
CDDcd000864.09E-12385445No hitNo description
SMARTSM003892.3E-9385449IPR001356Homeobox domain
SuperFamilySSF466897.27E-17386452IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-28388452IPR009057Homeodomain-like
PfamPF059206.5E-18402441IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009610Biological Processresponse to symbiotic fungus
GO:0009737Biological Processresponse to abscisic acid
GO:0010197Biological Processpolar nucleus fusion
GO:0010201Biological Processresponse to continuous far red light stimulus by the high-irradiance response system
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 710 aa     Download sequence    Send to blast
MATYFHGNSE IQGGGGDGLQ TLILMNPAYV GYSDTQQQQP PPSSNFVFLN SNSSGNNGHN  60
IPHAPPTQTQ HFVGFPLQGT TSAPAPPPAP AAPPQDPQQQ DVSALHGFLP RVQYNLYNLP  120
IDLGAARDVT RAQQGLSLSL SSQQPPGYGS FRPEREVPSQ PLVTAVSPPR GGEDVRVSGG  180
SPSSASGVSN GVNGVQSVLL SSKYLKAAQE LLDEVVNVGK GAKSATESSK GANGQPKNTG  240
DSSLAAAGDG QSGGEGSGKR GAELTTAERQ EIQMKKAKLV NMLDEVEQRY RQYHHQMQIV  300
ISWTSSAAGI GSAKTYTALA LQTISKQFRC LKDAILGQIR AASKSLGEED SLEGKIEGSR  360
LKYVDNQIRQ QRALQQLGMI QHNAWRPQRG LPERSVSVLR AWLFEHFLHP YPKDSDKLML  420
AKQTGLTRSQ VSNWFINARV RLWKPMVEEM YMEEMKENEK NGSEDKTSKS EQNEDSASKT  480
TAPQAKSPGT DHPNKNFISK QENPINQNAA PVISMSTNST SPTGTTLRNI AGFNLIGSTE  540
IESITQGSPK KLRNADILHS PSSIPSMNME SKPTDPHNEN MSMKFGNERQ GRDGFTLMGA  600
PTNFIGGFGS YPIGELGRFG TEQFQAPYSG NGVSLTLGLP HCENLSMSGA HQTFLPSQSI  660
QLGRGVEIGE TNDFGGMNTQ TNTHSTNVYD NINIQNRKRF AAQLLPDFVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A7e-16391449563Homeobox protein Meis2
3k2a_B7e-16391449563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011094236.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ560.0BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLA0A068UQ860.0A0A068UQ86_COFCA; Uncharacterized protein
STRINGGLYMA03G36070.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14782467
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-162BEL1-like homeodomain 1